Sequence for MER0041195

>MER0041195 - carboxypeptidase PM20D1 [M20.011] peptidase unit: 3-431 ( active site residue(s): 81,144 metal ligand(s): 79,110,145,171,414 ) (Nocardia farcinica) (Source: MEROPS) 
1        MDDATAERLAAALRCATVSGTGERADDSADGEFVRLAAHLEACFPRVHAELELERFGHSR       60
61       LYRWPGVEPERVSAILLAHQDVVPAGDGWTHPPFAGVVDDGFIWGRGAIDDKSRVLAILE      120
121      AVEAALAAGVRPRHTVYLAFGHDEEVFGDAGAVLMARRLRDAGVRAELLLDEGGVITEGV      180
181      ADGVSTPVASIMVGEKGYATVRLSVRETGGHSSMPGRQTAVGRIARAVARVQDRPLPLRL      240
241      TPVIADMLARLRTVMPPARRVLLGAAGVAGPVITRVMAARPQTEALVRTTTAPTVIRGGV      300
301      KANVLPQHAEALVNFRILPGDSVDGVLAHCRRVIRDRGVTVELVGMASEPSRTERPGPAF      360
361      DLVARLARQVVPGVAVTSGLVPGATDSRHYDGLAATRCNFAPIVLSEADLATIHGTDERI      420
421      SRVNYARLIEFNRRLIGELAAGPIGEEQR                                     449