Sequence for MER0041194

>MER0041194 - glutamate carboxypeptidase [M20.001] peptidase unit: 1-377 ( active site residue(s): 88,144 metal ligand(s): 86,115,145,169,348 ) (Nocardia farcinica) (Source: MEROPS) 
1        MIRRVDGEHDTLVRAGEALPDMVARLADLVGCESPSDSPADLRRCADLLVSWLAPLLPHR       60
61       VEVLERDGLPHVLAAAAHPTVLLLGHFDTVWPLGTLTDWPFTVRDGIARGPGVFDMKAGI      120
121      VQLVTALALHGDPGRVSVLLTGDEEIGSRSAWTLIEEQARRAGAVLVCEPAADGGAVKVG      180
181      RKGIANYDIEIRGRAAHAGLEPERGINAGVELAHQILALTALADRDTTVTPTVLSAGTTG      240
241      NTVPERAHCHVDVRSWTTAAMADVDRALTGLRPHLPGAEVVVTGGIDRLPFEERAAAGLL      300
301      AHAEAAADELGLGPLATATAGGVSDGNISAAAGVPTLDGLGAIGGYPHARDEHVQVHTMP      360
361      RQTALLTELLARLAQRRPGRLER                                           383