Sequence for MER0041193

>MER0041193 - subfamily M20F unassigned peptidases [M20.UPF] peptidase unit: 1-454 ( active site residue(s): 97,160 metal ligand(s): 95,129,161,187,426 ) (Nocardia farcinica) (Source: MEROPS) 
1        MTSEEPHVAALRARVAGLMGQAKQDLTQLVSFKSVADARQFPPQECEDAAQWVADACASV       60
61       GLTDVGLHETPDGTKAVIAARPAPPGAPTVLLYCHYDVQPPLDEAAWRTPVWTLTEREDG      120
121      RWYGRGAADCKGNIVMHLTALRALGPDLPVGVTLVSEGSEEQGTGGLEKFVVANPELLRA      180
181      DAIVIGDCGNFAPGVPTLTETLRGNVNVVVTVETLAGPMHSGMFGGAAPDAMTALVHLLA      240
241      TLHDADGNTTVAGLAADQGWDGVQYPPEQFRLDAGVLDGVDLAGSGTVSQMLWARPALTI      300
301      LGIDAPPVVGSAAAVQAVARARLNLRIPPGVEPEDAHRALVAHLHAHIPLHARLTVELEG      360
361      LGAPFRSSTGGPARAAMEAALTAAYGRPTTTQGQGGSIPLCNVFAETYPAAEIMLLGVEE      420
421      PSCLIHAPNESVDPAEIERMALAEALFLRDYAAR                                454