Sequence for MER0041191

>MER0041191 - aspartyl aminopeptidase [M18.002] peptidase unit: 3-429 ( active site residue(s): 86,263 metal ligand(s): 84,231,264,309,403 ) (Nocardia farcinica) (Source: MEROPS) 
1        MPVATTDATAAGLCAFVDDSPSPFHVCHTVAGELEAAGFTRLSESAAWASGEPGRYYVVR       60
61       GGSLVAWADRDGSPSAPFRVVGAHTDSPNLRVKQHPDLASAGWQLVGLEPYGGAWLNSWL      120
121      DRELGLSGRLTVREGNSVRARLVRIDDPILRVPQLAIHLSEDRRGVSLDPQRHVNAVWGV      180
181      GEKPRSFLAFVAEYAEVDPDAVLGWELMTHDLAPSRLVGRDRDLVSAPRLDNQGTCYAGL      240
241      RAFLAAVAEPGTAIPVLAMFDHEEVGSQSDRGAQSDLLPAVLERIVLARGGGRAEYLAAL      300
301      AGSVCASGDMAHATHPNYPERHEPAHRIEVNGGPVLKVNQNLRYATDATGAGAFALACAQ      360
361      AEVPLQRYVHRADLPCGSTIGPMTAARTGMPTVDVGAPQLAMHSARELMGAADVGAYAAA      420
421      LAAFLTPDG                                                         429