Sequence for MER0041190

>MER0041190 - family M17 unassigned peptidases [M17.UPW] peptidase unit: 23-503 ( active site residue(s): 280,354 metal ligand(s): 268,273,291,350,352 ) (Nocardia farcinica) (Source: UniProt Q5YZ53) 
1        MTAVADRSLGPELARTETLGPDTDVLVIGLTSSENGPSIAPDDMFGDVLTEDVRAELLDQ       60
61       LGAVGAKGKAEELTRVPAPAALEGVTSVLAVGLGAPDKLDAEQLRRSAGVAARSLTGTEV      120
121      VATTLGGIDIAAAAEGFYLGAYTFTPFRSAKSAPKPDERPVAKVEFLVPTADFGEEALFR      180
181      AQLVAEAVATARDFVNTPPSHLYPAEFAARTQVLAEAAGLDVEVLDENALEAGGYGGVLG      240
241      VGKGSSRPPRLVRLTYAGGPKKVALIGKGVTFDTGGISIKPAQNMENMTSDMAGAAAVIA      300
301      TTLLAARLSLPITVTATVPMAENMPSATAQRPGDVLTQYGGTTVEVLNTDAEGRLILADA      360
361      IVRAGEDSPEFLIDVATLTGAQMVALGTRTPGVMGTDEFRDRVARISQEVGENGWPMPLP      420
421      AELRADLNSKIADLANVAPHRWGGMLSAGLFLREFVPEGVQWAHLDVAGPAYNTGGPFGY      480
481      IGKGGTGVPVRTLIAVLEDIAAE                                           503