Sequence for MER0041189

>MER0041189 - BSSC8_26020 g.p. ({Bacillus subtilis}) [M16.A15] peptidase unit: 36-269 ( active site residue(s): 79,149 metal ligand(s): 76,80,156 ) (Nocardia farcinica) (Source: MEROPS) 
1        MSKKKTTTPLIPSGQGGPSLRQRVDEAVDSGVRRTVLPGGLRVVTEHVPGVRSASIGVWV       60
61       GVGSRDEGRTVAGAAHFLEHLLFKATPTRSALDIAQAMDAVGGELNAFTAKEQTCYYAHV      120
121      LDEDLPLAVDMVSDVVLNGLCRSADVDVERQVVLEEIAMRDDDPEDLVGDAFLTALFGDH      180
181      PIGRPVIGSVESIESMTAAQLRGFHQRRYRPDRMVVAVAGNVEHEHTVELVHRAFENRLD      240
241      PAAQPAPRREGRFRPHGAPELQWSFRDSEQAHLVFGVRAFGRHEGERRWPLSVLNTVVGG      300
301      GLSSRLFQRIREERGLAYSVYSSVDTFADTGAFSVYIGCQPENLGEVARLAKGVLEEVAE      360
361      HGVTDAECARAKGSLRGGLVLGLEDSASRMNRIGRSELSYGNHRSVSETLARIDAVTTEE      420
421      VAAIARTLLSRPFGVSVAGPYRRTRDLPAAVRRLVA                              456