Sequence for MER0041188

>MER0041188 - Zmp1 peptidase ({Mycobacterium}-type) [M13.009] peptidase unit: 1-677 ( active site residue(s): 512,579 metal ligand(s): 511,515,575 ) (Nocardia farcinica) (Source: MEROPS) 
1        MGILDCVTSELTSPSGIDLSHLDESVRVQDDLFAHVNGKWLADHEIPADRAVDGAFRALY       60
61       DQAELDVQAIIQRCARDDQDDADARRIGDLYASFMDTDTVAAAGLSPISAELAAVRDVTD      120
121      RGAFAALLGRLARTGVGGAVGCYVDTDDKDSSRYLVHLTQSGLGLPDESYYRQDEFAEIR      180
181      TTYIAHIGRMFALAAADPRIGALLPQDPDTVGQRIFELERRLAAGHWDVVRRRDAELSYN      240
241      LTTFDALVAEQPEYDWAAWTSALAEGVDRDGPELFAEVVVRQPDYLRTFARLWAEADLAD      300
301      WQAWAAWRILRARAPYLTDELVEENFAFYGRTLTGATENRVRWKRGVSLVQELLGEAVGK      360
361      LYVAEHFPPAAKARMQELVANLQEAYRRNIAELDWMSPETRQAALAKLEKFTPKIGYPDR      420
421      WRDYSGVRIDPADLVGNYRRGYAAEHDRDLRKLGGPVDRDEWFMTPQTVNAYYNPGMNEI      480
481      VFPAAILQPPFFDMNADDAANYGGIGAVIGHEIGHGFDDQGAKYDGDGNMVDWWTDADRA      540
541      EFAKRTKALIEQYNVLSPKDLPDEHTVNGEFTIGENIGDLGGLSIALEAYKISLNGAEPP      600
601      VIDGLTGLQRVFFGWAQVWRTKARAEEAIRRLAIDPHSPPEFRCNAVVRNIDSFHEAFDV      660
661      RPGDALYLDPAERVKIW                                                 677