Sequence for MER0041187

>MER0041187 - Zmp1 peptidase ({Mycobacterium}-type) [M13.009] peptidase unit: 36-693 ( active site residue(s): 533,600 metal ligand(s): 532,536,596 ) (Nocardia farcinica) (Source: MEROPS) 
1        MTENGAAPGRRACGLRWDRRRFLTVGAAVPLAVTLASCAGEDAAAPTGTAGPDLTGVDPA       60
61       VRPQDDLFRHVNGGWLRDYRLPPDKASHGTFEELADRTEDRLREILEAPDDAGPGTDARR      120
121      LRDLYRAYLDTAAIEAAGTRPLADLLGEIDAAATKSDLARVAGALHALEVTGPVWLRVEP      180
181      DRKDSTRHRPYLVQSGLGMPDEAYYREPVHSELRTAYRGYLTRIATAAGLPDPAGVAERV      240
241      FDLETQLAAGHVDMVRWVDSLSSYHPWSWTELRDRAPGFDWDAWLDGLGGQRARFETVLV      300
301      DQPEYPAALARLWEAEDAGRWREYLRLRLFDHYAPVLPAAFADAHFDWAERAQTGIQQPP      360
361      PRWRAAVRFVRTKMGDALGREYAQRHFPTESKRQVEQLVEDLLAAYRQRLAEADWMSEQT      420
421      RRTALAKVDKIVALIGYPDTWRDYSGLVVRPGELLASLRAVENHEFRHRLGRLDRPVDRR      480
481      EWTMLTPVEVNANYSWEINHIVFPAAILQPPFFDPAAAPAVNYGAIGVVIGHEIGHGFDT      540
541      GGSRYDENGTLRDWWTSADKAAFETKTKAVIAQYDPLVPAGMPPDRRVNGALTVTENLAD      600
601      IRGVSTALAAYRIAAARAGAAEPDWRALFLSYARIWRHTATPEYTAATLGLDSHAPAEFR      660
661      VNQVVRNMAEFHTAFEVRPGDGMYLAEHERVRL                                 693