Sequence for MER0041186

>MER0041186 - lysyl endopeptidase ({Streptomyces albulus}) [M01.033] peptidase unit: 260-422 ( active site residue(s): 306,381 metal ligand(s): 305,309,328 ) (Nocardia farcinica) (Source: MEROPS) 
1        MRSADGREVLMGDKFYDEPIDDYLPQNGNRGYRVSRYELDLVYKVAGNRLSGRAEITAVT       60
61       TAVRPRFAFDLAQSLSVAKVFVNGAKVARYTHRNGKLVLTPQQKIPAGGVLAVVVQYAGA      120
121      PKPVRGPWGEVGWEELTEGALVASQPNGAASWFPCDDHPSSKASYRISITTDSPYHALAN      180
181      GTLVRKQTKASQTTWVYEQPEPMSSYLATIQIGPYRRHRIGSEQSPVPMYAVLPARLRAA      240
241      FDTDFARQQRMMEVFTDLFGPYPFAGYTVVVTDDDLEIPIEAQGISIFGANHCDGRRGSE      300
301      RLVAHELAHQWFGNSLTLRRWRDIWLHEGFACYAEWIWSEAAGGPSADQLARAARHNLSR      360
361      EPQDLVLADPGPALMFDDRVYKRGALTLHALRIELGDRAFFDLLREWTGRYRHACVDTEE      420
421      FTDLAGHYSQVPLRPLWDSWLRETALPPLPPHGGQAVTVPR                         461