Sequence for MER0041185

>MER0041185 - family M1 unassigned peptidases [M01.UPW] peptidase unit: 295-455 ( active site residue(s): 335,412 metal ligand(s): 334,338,357 ) (Nocardia farcinica) (Source: MEROPS) 
1        MNPLPCWSSRCDRTGAGHGRKGWWRVRWAVLAGVATLGLVLTGTGAAPAGADPFVGAPGL       60
61       DDPYYPLDGNGGYDVRHYDVRIGYDPPSRWLDGTARIDAVATQLLRAFNLDYSGPPVDAV      120
121      TVNNQPAAFERHGEHELTVTPLLPLLPGLPFTVTVHYAGPAADTAGAGWTLTPSGGAFAA      180
181      GQPHSASTWYPLNDTPRDKATFALHATVPAEWEVVSNGVRTENTVRDGSRTVGWASAHPV      240
241      IGYLTTIAIDRFSFLEQARANGTPILSAFAPAAERNRATEQRLPEILDFTEELFGPYPFD      300
301      AAGGIYVDADLSFSLETQTRPVYAPWTDLATVVHEIAHQWWGDSVSVRSWSDICLNECFA      360
361      SYTADYLWPERMDGVDVDARYRETVAEFHDNPRFWEIPLENPGAGREFTSVYYRGPLFLH      420
421      ALRRQLGDEVFFPALREFLATHAYGNASMPELRTFLQSKSATDLTGFFTAWLNDTAPPPA      480
481      EYLYPGTLGTPDR                                                     493