Sequence for MER0041184

>MER0041184 - aminopeptidase N (actinomycete-type) [M01.009] peptidase unit: 235-428 ( active site residue(s): 304,389 metal ligand(s): 303,307,326 ) (Nocardia farcinica) (Source: MEROPS) 
1        MSAPNLTRDQAIERAATVRVENYRIELDLTDQSADVSGVRTFGSRTTVTFTATPGASTFI       60
61       DIVAARVRSAVLNGTALDVSGYDESTGITLPGLAERNELVVEADCEYSHTGEGLHRFVDP      120
121      ADGKVYLYSQFETADAKRMFACFDQPDLKATFDITATAPLDWEVVSNGAGGRTEVGEVAV      180
181      HTFATTPRMSTYLVAMIAGPYAKWTDTYRDEHGDIPLGLYCRASLAEHMDAERLFTETKQ      240
241      GFGFYHRNFGVPYAFGKYDQLFVPEFNAGAMENAGAVTFLEDYVFRSKVTRASYERRAET      300
301      VLHEMAHMWFGDLVTMKWWDDLWLNESFATFASVLCQAEATEYTSAWTTFANVEKSWAYR      360
361      QDQLPSTHPIAADIPDLAAVEVNFDGITYAKGASVLKQLVAYVGLEPFLAGLRAYFAEHA      420
421      YGNATFDDLLTALEKSSGRDLSTWGAQWLKTTGLNILRPEFDVDADGRFTSFAVVQEGAQ      480
481      PGAGERRVHRLAVGVYDDQDGKLVRTHRVELDLDAAERTEVPELQGVARGKLVLVNDDDL      540
541      TYCSVRLDPESLDVLVNRIADIAEPLPRTLAWSAAWEMTRQAEFRARDFVALVQRGVGAE      600
601      TEIGVVQRLLMQAHTALAGYADPAWAEGVGWTEFADRLLELAREAEPGSDHQLAFVNALT      660
661      GARLEARHTEVLTELLDGDPAAVGLAGLTVDTDLRWRLVTALAAAGEIDADGLETPVIDR      720
721      ELAADPTAAGKRQAAAAATARPQAEVKAAAWATVMEDDTVPNITARSIVGGFAPVGQSEL      780
781      LAPYVERYFADIPAVWERRSSEVAQTVVVGLYPAWAISAEAVAVADKFLAGDHPPALRRL      840
841      VSEGKAGVERALRARAFDAR                                              860