Sequence for MER0041182

>MER0041182 - PfpI peptidase [C56.001] peptidase unit: 34-176 ( active site residue(s): 87,113,114  ) (Nocardia farcinica) (Source: MEROPS) 
1        MAELDGVRVLIVTSNTGVERDELLVPRDRLRERGARVTHAAPKPEQVQTFQHDLDPAQAV       60
61       EPDSALDGVDADDFDVLVVPGGTVNADKLRLEDRAVALAKDFAGAGKPIAAICHGPWLLA      120
121      EADLVSDKTLTSYPSLRTDLGNAGGRWVDEPVVRSTERDWTLITSRNPGDLDDFVTAIVR      180
181      EVSAR                                                             185