Sequence for MER0041181

>MER0041181 - family C56 non-peptidase homologues [C56.UNW] peptidase unit: 34-145 ( active site residue(s): 79,104,105  ) (Nocardia farcinica) (Source: MEROPS) 
1        MQIAVYAFDGFPMFHLAVPLTVFGEVGRLGLAADWQTRLWSDRAGSVRTAEGYPIGDVAG       60
61       PEILASADIVVVPSWLQSLAPAGDDLKNQLIDAHRRGATIAGLCFGAFPLADAGLLDGRA      120
121      AVTHWEVLPLLAERRPDTSVDASVLYIDHGDVLTSAGTASAIDACLHLVRKHLGVAAATR      180
181      VARSLVVAPHREGGQAQYIERPLARPATDGAIGEVLDWALAHLDHPLTVDLLAERARMSR      240
241      RSFVRHFQQATGTTPARWILDRRLDEARALLETTDWPVDTIASACGFGSPVTLRQNFAAA      300
301      YGTTPTTYRRRFAPTPA                                                 317