Sequence for MER0041180

>MER0041180 - family C56 unassigned peptidases [C56.UPW] peptidase unit: 94-161 ( active site residue(s): 113,139,140  ) (Nocardia farcinica) (Source: MEROPS) 
1        MAEILFVMSGADHWTLADGTKHPTGFWAEEFVAPYEVFTAAGHTVTVATPGGVVPSVDRG       60
61       SLAPEVNGGPENAAKLAEAVRTAAPLQHPVPLAEVDPADYAAVFYPGGHGPMEDLPTDAD      120
121      SGRVLAQALSSGTPLGVVCHGPAALLATADADGNSPFAGYRLTAFSNAEEEQAGLAAKAP      180
181      WLLADRLRELGVEYREGEPWAPHIEVDRTLYTGQNPASSRPLAEEIVRALG               231