Sequence for MER0041179

>MER0041179 - family C56 non-peptidase homologues [C56.UNW] peptidase unit: 33-144 ( active site residue(s): 79,93,94  ) (Nocardia farcinica) (Source: MEROPS) 
1        MESTDRDDVVVALADGVLLLDVAGPVQVLHWARRRVRFASLDGGPVRTDVGAPLGADCAF       60
61       AEVAARIDTLLVPGFAPDDRPDSRLVAAVGALAGRARRVAAVCTGAFVLAEAGLLDGRRA      120
121      TTHWMGCGELARRFPRVAVQPDAIYVRDGGVVTSAGVTAGIDMALALVEEDQGQELARTV      180
181      AKQLVVFLRRPGGQSQFSVRAQIAGPRADGVRAVVDAVIADPAGDHSLPALAARAAMSER      240
241      HLSRLFRRELGTTPGRFVERARVEAAQHLLEASTDPIPVVARRCGLGSEETLRRTFVKVL      300
301      GVTPSDYRARFRAH                                                    314