Sequence for MER0041178

>MER0041178 - family C56 non-peptidase homologues [C56.UNW] peptidase unit: 41-158 ( active site residue(s): 92,117,118  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTGRTVAMAIAPGALHPWDLYELGVVAAIFGTPQPDLADPWYTLRVCAVAPDQGEQSIGF       60
61       GAFLRPEHGLAELLAADTVIVPSVAAHCRTGERALPAELLDALVAAHRRGARLVALCDGV      120
121      FALAAAGILTGRRVTVHWEHAGLLARRHPDLVVDDSVLYLDDGDVLTSAGMTAALDLCLH      180
181      LVRRDLGATVANRLARRMVIPPHRSGGQAQYVDRAVPADPRDDLGPVLQWAAAHLDQPLT      240
241      VDLLAARANMSTRTFHRRLQRAGGVTPKQWLLNQRLAYARSLLESTDLTVEAVARMAGLG      300
301      TATNLRRHFTTALGVTPADYRRTFARREPGTPPRDGAVA                           339