Sequence for MER0041177

>MER0041177 - family C56 non-peptidase homologues [C56.UNW] peptidase unit: 35-144 ( active site residue(s): 79,93,94  ) (Nocardia farcinica) (Source: MEROPS) 
1        MHVVAVLALDRVIPFDLSTPLEVFTRTRLPDGRPAYRVRVCAERPQVDAGTFTLRAPWGL       60
61       DGLDGADTVIVPGVADPASPPSPAVVAALRRAAAAGTRIASICTGTFPLAATGLLDGLRA      120
121      TTHWAAAEALARAHPAVTVDPDVLYVDNDGRVLTSAGAAAGLDLCLHLVRRDYGSAVAAD      180
181      AARLAVMPLEREGGQAQFIVAPLPPAPRGSALEPLLIWLQDNLSRPLTLAEIAAHAGTST      240
241      RTLLRQFRDQTGTTPLRWLHRARIHRAQHLLETTDHTVERIAAQVGFGSPTTFRERFTRV      300
301      TGVTPHAYRRSFR                                                     313