Sequence for MER0041175

>MER0041175 - family C56 non-peptidase homologues [C56.UNW] peptidase unit: 18-128 ( active site residue(s): 64,90,91  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTALDAIGPYEVLRFAPDTEIRFVGHEVGPVVTDSGVLALGVTHTFAETPAPQIVVVPGG       60
61       PAATAVAADTAVLDWLRAAHRTAEWTTSVCTGALVLAAAGLLDGKPATTHWAAQSALGLL      120
121      GAQPRKQERVVRADARIVTAAGVSAGIDMALWLVAEIHGADRARTVQLDIEYDPRPPVDA      180
181      GHPSKASSAVRRASMADQAKLMRALTAGELARTVTGAQLALWRGALRRVRARIG            234