Sequence for MER0041173

>MER0041173 - family C56 non-peptidase homologues [C56.UNW] peptidase unit: 35-148 ( active site residue(s): 75,97,98  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTIVAVLASEGAVGFEVMLPGVVFGAANTVCADDRYEIRIVTPEEGATTGAVHGRVRLQS       60
61       DWGIDTLAAADIVVVPGRDDYRTEPSAAVCQALRAALARGARVASVCVGAFTLAAAGLLD      120
121      GLRATTHWAHAAELARRYPQVEVDPSVLFIDNGPVLTSAGIAAGLDVCLHLVRQDLGAQV      180
181      AADTARRIVMPPQRDGGQAQFIAHADPADPDTSLQPVLDWMQANLHRPLTLDDIAAHGAM      240
241      SVRSLNRRFRAEIGTTPLQWLLRARVHRAQQLLETTGLSVDRVAEESGFGSATTLRYHFT      300
301      RLTRTSPQAYRTTFQHGDAGDRESALARSSR                                   331