Sequence for MER0041172

>MER0041172 - family C56 non-peptidase homologues [C56.UNW] peptidase unit: 36-151 ( active site residue(s): 84,110,111  ) (Nocardia farcinica) (Source: MEROPS) 
1        MLSKVAVPLFEKLAMFEFGVVCEVFGLDRTADGLPGFDFKVCGAEPGKPLRSTTPGVTVT       60
61       PEYDLAELARADLVAVPAAPVSALTGDLDPQLVEAVRAAADAGATVLTVCSGAFVAGAAG      120
121      LLDGRKCTTHWRYVDQLAARYPKATVDPDVLFVDEGDLITSAGTAAGIDACLHLVRREIG      180
181      SAAANGIARRMVVPPQRDGGQRQFIERPVADCEADSLGETLLWMSEHLELPHTVESLAAR      240
241      ASMSTRTFARRFAAETGTTPVKWLTNQRVLRAEHLLEETDLGLEQIAARCGFGSGALLRH      300
301      HFQRQVGIAPTEYRRRFGRRPS                                            322