Sequence for MER0041171

>MER0041171 - family C56 non-peptidase homologues [C56.UNW] peptidase unit: 37-151 ( active site residue(s): 84,109,110  ) (Nocardia farcinica) (Source: MEROPS) 
1        METRTVHTAVYDTLADWEVGAAIAHINNPEWQRNPGSFEVRTVGLTRDPIRTKGGVRIVP       60
61       DLALGELTPEQSAGLILPGADTWVPGDLAPFAAAAAGFLDAGVPVAAICGATYGLAAAGL      120
121      LDTRKHTSNAPQFLAASGYAGADHYVEQPAVSDGVLVTATGTAPFEFAREVLRVLDVYEP      180
181      HVLDAWYRLFAHNDVSAFLALQDHAAAE                                      208