Sequence for MER0041170

>MER0041170 - family C56 non-peptidase homologues [C56.UNW] peptidase unit: 48-160 ( active site residue(s): 95,109,110  ) (Nocardia farcinica) (Source: MEROPS) 
1        MIPVQVLRPGPELTRRRRIGVLVFDGVKMLDFAGPAEVFVEANQSVPGYEVVMLSPDGAP       60
61       VHTSIGTQVGVTGSALAAHDLDTVVIPGSEQPPARFVTPEVLAATAHLAARTRRLASICS      120
121      GAFVLAELGVLDGRRATTHWKFTRDLAARYPRVRVEPDAIFVRDGRVYSSAGVAAGIDLA      180
181      LALVEEDHGAAVARRVAQSLLVFMQRAGGQSQFSAALTGPVPRSALVRELTDLIYADPAR      240
241      PYPVQMLAAHARVSTRHLTRLFREELDSSPAEYVAHVRFAFARDKLDAGHSVTEAALLAG      300
301      YGSSEAMRRAFVARLGVSPKKYQQRFRTTAPDRDTTRV                            338