Sequence for MER0041169

>MER0041169 - family C44 unassigned peptidases [C44.UPW] peptidase unit: 4-349 ( active site residue(s): 4  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSRWCAFLTEDDPAAHVRAVGAEPITAGPITAGSITAAGPHGFGLLDGPGVAAGPFTAGA       60
61       LTAVGEVTLFNADRLRARLGADAPPPGRPDGEVLLHSYARFGLDGIAAAEGMFALAVADG      120
121      PDLVLLRDQLGARTLFHARARAGWAASTSLRALRRWPALRTGLHLPAVRSFLTFAYLPGR      180
181      ETLLRDVHEVLPGRCLRLHPDGTSTEHTYWEPREHIDERPASEHALRLRALLEDAVTRRL      240
241      PAGEPVGVLLSGGIDSSLVTALAAKLHDQAVHTYSISFGADAPDELGYSGLVATHCHTRH      300
301      RVLTVPGQTVAARLADTVGLLDSPVGDPLTVPNLMLAEAVAADGIRVALNGEGGDPVFGG      360
361      PKNLPMLIFELTRDDPAEDARAHAYLDSYRKCYADLPALLTRDALAALADAPGPVEHVAP      420
421      YLRPGAMTSLLNQLLHTNLRTKGAHHILTKVERLTAASGIEGRAPLFDRAVVDHAFAVPP      480
481      TMKLAGTSEKWILKQAVRDLLPKTIVDRPKSGMRVPVQQWLDGPLRELAHDLLLGRTARE      540
541      RGLFRADTIRAWLRGEGALLPRQGGKLWLVLSLQLWLRSFDLEESVR                   587