Sequence for MER0041168

>MER0041168 - family C40 unassigned peptidases [C40.UPW] peptidase unit: 83-190 ( active site residue(s): 107,154,166  ) (Nocardia farcinica) (Source: MEROPS) 
1        MANNTVKRQAQRVVAAGAVGAATIGAFLLPAAPASAQPVTIPGVGTFEVPNEIPIPAEIP       60
61       GIQLGQPGPPPFVAPQKTVGELALDAALSKIGSPYVYGAAGPNAFDCSGLVQWSYRQAGL      120
121      ELPRTSGAQLSAGSPVSLDDLRPGDLVSFYGGGHSGLYAGDGNVVHAATSGSPVHIASIS      180
181      SMPVAGARRF                                                        190