Sequence for MER0041167

>MER0041167 - family C40 unassigned peptidases [C40.UPW] peptidase unit: 32-140 ( active site residue(s): 56,103,115  ) (Nocardia farcinica) (Source: MEROPS) 
1        MGKHSLQRESRLPNSVKGALVMGAVAATGAMPAVPAMAATVNIPGLGDFDVPVPQEFEQP       60
61       VQQLNQQLQQALAAPQGGVQQAPLAAPQFPSFQIPAPFQQTTPGDIALDAAKTKVGAMYS      120
121      WGAAGPSTFDCSGLVKWAYRQAGIELPRTSFEQSHVGAPVAFEDLRPGDIVVTNGGGHVG      180
181      LYAGDGKLLNAVQSGQPVSYTPLRPDMVVTARRIAD                              216