Sequence for MER0041166

>MER0041166 - family C40 unassigned peptidases [C40.UPW] peptidase unit: 341-462 ( active site residue(s): 386,435,447  ) (Nocardia farcinica) (Source: MEROPS) 
1        MRESRRAGQRSKLWVAVGLLICTALVVSAGPGTAVPPPPPNPSDGQIADAGARVEAGIGE       60
61       VGALINQVADVEHQLRELDDAVAVRREEVNKALVDLQNARAAADAAAARVETTQRDLATA      120
121      GEEVARARHNFDDFATRAYTRPASGSMVTYLAAATPTGAIDRSEVLGLVSKNQQQVLDAL      180
181      RRAQIEQGNRNSDAREAKSLADAAAAAAEQKKAEAESAVAAAKAALDSETVRRDGLLRER      240
241      DAAQSRLDAARANVQGLQNQREAYQAWDAQRRAEEAEAIRVAAAAAAARAAADQAARERA      300
301      AQLGEGKRPHTELEDAPAPKKSTTPKPSSPSVSGSAAVEVVVDRALSQLGVTYAWGGGDE      360
361      DGPTLGIRDGGVADSYGDYNKVGFDCSGLMVYAFAGIGVSLPHYSGYQYNAGTRVPLAQK      420
421      ARGDMLFWGPGGSQHVALYLGDGKMVEAPQSGDVVKVSPVREDGIMPYAVRIVTS           475