Sequence for MER0041165

>MER0041165 - family C40 unassigned peptidases [C40.UPW] peptidase unit: 266-357 ( active site residue(s): 290,335,347  ) (Nocardia farcinica) (Source: MEROPS) 
1        MIDINVLVKPLLDLLSSFGSGVLPSGGPSDALVSASTALEQLHQQGRASINQMNSAWDGV       60
61       AADAATAKALRVQTSAATISDRGTEMATVVNQAAAQVETGQKDLNGIVQSFVNTATALGP      120
121      TLATPQGLTVLVGSAIEHLNQGLAVVGRVRSELDTQTAAITQLTPPPSTPPVASLPGALA      180
181      GGASSGLQGLMGMVSQAGSLATTMASTPLKQVSKAANTGTTPSSAAPSGQNPNSSTSTTA      240
241      TTDGVKITLPDGSVVEAPNEKAATAVQAAIGAVGTPYVWGGNDPGSGIDCSGLTKYAYGE      300
301      AGVELPRLAQEQHIGHPQVSPGDLMPGDLAVWDGHVAMVIGNGQLVEAGDPVSISSIRTE      360
361      NMGMEFYGFYRPTA                                                    374