Sequence for MER0041163

>MER0041163 - YddH peptidase [C40.007] peptidase unit: 246-354 ( active site residue(s): 270,318,330  ) (Nocardia farcinica) (Source: MEROPS) 
1        MVADHRPHRTRRLLGGILVAGVLATGVCASGPAIADPVALPATASEAVQRMIELSRQSEQ       60
61       LNQQALGAQADLDAKLAAQQAAEAELATRTAAVEAARAEVRRFQPVIDRTAIAAYQGART      120
121      NRMFAVLVSDSPQQLLDQMSTLDVLSAQTSEELRRFKKADDAAVAAESAARAAADTARAA      180
181      AAEAERVRADLERKRSELGGAIAQVVQAWGALSTRDKSALAGSPFPPGFDRDTLLQGLVP      240
241      GSGTSALAAGLTRVGDPYVWGATGPHQFDCSGLVQWAFKQVGKDVPRTSSAQASYGTPVA      300
301      KEDLQPGDVVFFYPDISHVGIYAGNGLMLHASTFGVPVAVAPMDSTPYHSARRY            354