Sequence for MER0041162

>MER0041162 - family C26 unassigned peptidases [C26.UPW] peptidase unit: 76-372 ( active site residue(s): 258,348,350  ) (Nocardia farcinica) (Source: MEROPS) 
1        MSADTAAALVLEDGRVFRGTAYGAVGQTLGEAVFCTAMTGYQETLTDPSYHRQIVVATAP       60
61       QIGNTGWNDEDDESQRIWVAGYAVRDPARRVSNWRATRSLPDELDRQGIVGIAGIDTRAL      120
121      VRHLRTRGSMKAGIFSGAALADAEELLARVTGQPSMLGADLAEEVSTDGVYTIEPTGDHR      180
181      FTVVAVDLGIKTNTPRMFAQRGIRVHVVPSTTSLDQVLELKPDGVFLSNGPGDPATQNDA      240
241      VAITQGVLERGVPLFGICFGNQILGRALGRETYKMKFGHRGINIPVVEHETGRISITAQN      300
301      HGFALEGERGEQFDTPFGRAEISHVCANDGTVEGVRLLDGRAFSVQYHPEAAAGPHDAAY      360
361      LFDRFAGLMEGA                                                      372