Sequence for MER0041161

>MER0041161 - aminodeoxychorismate synthase, subunit II [C26.955] peptidase unit: 23-214 ( active site residue(s): 83,172,174  ) (Nocardia farcinica) (Source: MEROPS) 
1        MRVLVVDNYDSFVFNLVQYLGQLGTDAVVWRNDDQHLADLDAVAADFDGILISPGPGTPD       60
61       RAGASIDLVRACARTATPLLGVCLGHQAIGEAFGATVTRAPELLHGKTSSVFHVGAGVLA      120
121      GLPDPFTATRYHSLTVLEDTLPAEIEVLGRTESGIVMAMRHRELPIHGVQFHPESVLTQG      180
181      GHRMLANWLGVCGSRPPEGLVEMLESEVAALVPQ                                214