Sequence for MER0041160

>MER0041160 - trp1 ({Schizosaccharomyces pombe}) [C26.A25] peptidase unit: 1-230 ( active site residue(s): 82,170,172  ) (Nocardia farcinica) (Source: MEROPS) 
1        MRTLLIDNYDSFTYNLYQLISEVNGVEPTVVRNDETDPAALDLAAYDNIVVSPGPGRPDR       60
61       TRDVGLSAAVIDAASQPLLGVCLGHQGIVVAAGGRVDRAPVPRHGFLDRVGHDGRDLFAG      120
121      LPQDFTVVRYHSLCALEPLPPALEVTARTPDGVIMGVRHRQRPQWGVQFHPESVAGEFGA      180
181      ALLRNFAELTLAHGKPARRTRPATPVTPARPAATDRPRWRLRHEVIERAVDTEAAFLRLY      240
241      GASPTAFWLDSEHVEPGLDRFSFLGDASGPLAEVVRYRVGADVVRVEDAAGTRTVAGDVL      300
301      GYLSTQLRERHVELPALPFDFVGGYVGYLGYEVKADCGARAAHRAATPDAQWIFADRLIV      360
361      VDHVAGQTHLVALTDDDTAADQWLRETGRVLETLPAWANPAELAIESAPASVAPLLNRGR      420
421      DRYLADIAACLEYLRAGESYEICLTDSLTVDAAIGGLDFYRTLRRCNPAPYAAYLRFDDL      480
481      EIACSSPERFLKIDRARTVESKPIKGTAPRGATPAEDERLRRELADSPKTRAENLMIVDL      540
541      LRNDLGRVCQIGSVHVPELMATESYSTVHQLVSTVRGTLRPDVDAIDCVRACFPGGSMTG      600
601      APKLRTMEIIDELEGAPRGVYSGTIGFLGLGGTADLNIVIRTAVRHDGRWRIGAGGAIVL      660
661      DSDPAEEYREMLWKAAATQRAATAAAATSR                                    690