Sequence for MER0041159

>MER0041159 - At1g63660 ({Arabidopsis thaliana}) [C26.A07] peptidase unit: 1-230 ( active site residue(s): 84,170,172  ) (Nocardia farcinica) (Source: MEROPS) 
1        MAETQRPVLVVDFGAQYAQLIARRVREASVYSEVVPHTATVEEIAAKKPLAVILSGGPAS       60
61       VYAEGAPQLDPRLFDLNLPVFGICYGFQAMAQALGGTVAHTGTREYGRTELNIDGGVLHG      120
121      GLPTIQPVWMSHGDAVTDAPEGFEVTGTTAGAPVAAFEDRARRLAGVQYHPEVLHSPHGQ      180
181      QVLSRFLHELAGIPASWTPSNIADVLVEQVRAQVGDGHAICGLSGGVDSAVAAALVQRAI      240
241      GDRLTCVFVDHGLLRAGEREQVQQDFVASTGAKLVTVDAVDKFLGELKGVTDPEEKRKII      300
301      GREFIRSFEDAVRQIVDEQGAAEGKQPEVEFLVQGTLYPDVVESGGGTGTANIKSHHNVG      360
361      GLPEDLEFELVEPLRLLFKDEVRAVGRELGLPEEIVARQPFPGPGLAIRIIGEVTADRLA      420
421      TLRQADAIAREELTAAGLDRQIWQCPVVLLADVRSVGVQGDGRTYGHPIVLRPVSSEDAM      480
481      TADWTRLPYEVLERISTRITNEVAEVNRVVLDVTSKPPGTIEWE                      524