Sequence for MER0041158

>MER0041158 - subfamily A24A unassigned peptidases [A24.UPA] peptidase unit: 8-140 ( active site residue(s): 20,77  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTSFAFVLLAAWCAALTVIDLRTRRLPNVLTGIGAAAVLGYAAGSGRLGVALGGALLLAL       60
61       PYLLVHLLAPTACGAGDAKLAVGLGAAAGLGGSTAWVAAALGGPLLTAAVGLVVLGARGP      120
121      ATRGSPADRRLPHGPAMCAATLLALLPVAG                                    150