Sequence for MER0041157

>MER0041157 - signal peptidase II [A08.001] peptidase unit: 25-183 ( active site residue(s): 133,162  ) (Nocardia farcinica) (Source: MEROPS) 
1        MPHTPGTEARHGPRSAREMMIGVNDDQRPPLRLRTLLIIAFCLYALDLLTKCLAVALIDP       60
61       GEPVPVIGDFARLALVRNPGAAFSMATGMTWLLTLIATAVVIGVIRIGRTLRSLWWAIGL      120
121      GMVLGGALGNLTDRLFRSPGPLQGHVVDFVAVGDFPVFNVADSAIVCGATLLVVATVFGF      180
181      EPDGTRVGRDDENDDAANEDGTDTDTAGEDGTAPEPDRPSPPPTDSERKGSESKGEENAA      240