Sequence for MER0039099

>MER0039099 - family C44 non-peptidase homologues [C44.UNW] peptidase unit: 77-299 ( active site residue(s): 77  ) (Nocardia farcinica) (Source: MEROPS) 
1        MCGIVGLHLRDATLYPRLGALLTGMLDQLCDRGPDSAGMAVYGDPTWSPPGESTVSLLDA       60
61       GLPAADLAARLTAALGVPVTGLDLAPTTVLHAPLDAAALSAAVPDIAPHARVIGFGTDLT      120
121      VLKGVGHPTALAHRFGLPAAAGWQGVAHTRMATESAVTAAGSHPFSVGPDQCLVHNGSFS      180
181      NHRSVQHELRRAGVVFDSDNDTEVGARFIAAQLAQGVDLEKALTLLNERFDGFYTLLVAD      240
241      SESFAVVRDPIACKPAVVAETDRWVAMASEYRALADLPGVADAHIFEPEPEEVYLWHRQ       299