Sequence for MER0038384

>MER0038384 - At4g38880 ({Arabidopsis thaliana}) [C44.A02] peptidase unit: 1-247 (Nocardia farcinica) (Source: MEROPS) 
1        MFGVWAPSEDVAKLTYYGLYALQHRGQEAAGIAVSDGQQILVFKDLGLVSQVFDEQTLAA       60
61       MPGHIAVGHCRYSTTGGVTWENAQPIFRTTAVGSGLALGHNGNLVNTAELAGRARELGLI      120
121      GTPVSGGRPQPVGATSDSDVMTALLAHAAADSSIEQAAMELLPQLRGAFCLTFMDEHTLY      180
181      AARDPHGVRPLCLGRLDRGWVVASETAALDIVGAAFVREIEPGELLAIDAEGVRSMRFAN      240
241      PEPKGCVFEYVYLARPDSTIAGRSVHATRVEIGRRLAKEHPVEADLVIPVPESGTPAAVG      300
301      YAQGSGVPYGQGLMKNAYVGRTFIQPSQTIRQLGIRLKLNPLREVIRGKRLIVVDDSIVR      360
361      GNTQRALVRMLREAGAVEIHVRIASPPVKWPCFYGIDFASRAELIANGGGADDSYDDMVE      420
421      AVRRSIGADTLGYISTEGMIAATEQPRTRLCSACFDGQYPIPLPTEASIGKNLLEGMLTG      480
481      QPESVLLGDNANASALSRP                                               499