Sequence for MER0038373

>MER0038373 - family S33 non-peptidase homologues [S33.UNW] peptidase unit: 1-325 ( active site residue(s): 104,268,301  ) (Nocardia farcinica) (Source: MEROPS) 
1        MTVTERPTSRIVTNDGIRMHVTERGAGQPVIFCHGFPHTGFIWHRQLDALAAAGYHALAP       60
61       DLRGYGRTDAPADPEAYTNRAVIGDLLALLDDLAAERAVFVGLDFGAVLVWELAQRAPER      120
121      VRGVIVLNNPYAPRPSRAPSQLWAKAAQRHFLHLDYFQRPGVADRELAAAPRDFLARVYY      180
181      ALSGDYHYLDTWRFPPGSGYLEVLPDAPALPWPWLSAAEFDVLAAEFERTGFSGGLAWYR      240
241      SLDRNWELGADLDPTVRVPAYFVYGEKDPDMAGFSGRDPLGVMRAHVPDLRGVTEIPGAG      300
301      HLLPLERGAEVDRLVLAHLTDLGLA                                         325