Sequence for MER0038343

>MER0038343 - family S33 unassigned peptidases [S33.UPW] peptidase unit: 4-259 ( active site residue(s): 117,197,225  ) (Nocardia farcinica) (Source: MEROPS) 
1        MVKYPEAQNFWHYRRMVFFDGARGRMHYRRWPVDSPLAVTVLLHGLGQHSGHYHRFARTL       60
61       RAVDVEVWGLDFAGHGLSEGDPEQPGTLAELVADATALVERVHAAHPDRPLLLMGHSLGA      120
121      VTALGMLGAAVPDTTSESDLNAVEASYPLTPSLPVAWLAGLVLSGVPRRALGGGAPGAPG      180
181      TPLPAQLPVLAVHGVEDRRAPVEGIRGWTARHESVDLREYAEAGHDLLHEPVQARVAADI      240
241      AEWMRAIVAAEAVVGSGRRH                                              260