Sequence for MER0038302

>MER0038302 - family S1 unassigned peptidases [S01.UPW] peptidase unit: 108-257 ( active site residue(s): 127,173,252  ) (Nocardia farcinica) (Source: MEROPS) 
1        MPSEEHTMTVIDPAPGHLLERTEIPTTVKELVHAIPGQEQHALNPAEAPARGDAVTAPYC       60
61       PPWATYAEPTVAETFSLDGQTFYEPLVHEEPNPMLYPMCTVGIVFNSNGKRGSGVLVGPN      120
121      LLLTAGHVAPWGASNWSMEFIPAFRNGDRPFGSSFVQSYWGYNPGGDVPTGYDYVICKLY      180
181      NPLGNALGWMGSQSWGDEDEYYNRRYVSSGYPGSYGQRPAVELDMGIRDIDNDSPGKELE      240
241      FALRADLGPGWSGGPLWVHTANPFVVGVCSGQEKDGLDPTRLVFAGGKGMVDVVRHGLTD      300
301      MRP                                                               303