Sequence for MER0038260

>MER0038260 - family M19 non-peptidase homologues [M19.UNW] peptidase unit: 5-249 ( metal ligand(s): 9,11,85,152,173 ) (Nocardia farcinica) (Source: EMBL nucleotide AP006618) 
1        MSPFLWEQHCCLPLTPDAEVAELARYPLGSYLSVNVGYSRQRTTDTLELLHAFRAAAVAD       60
61       GRFRLVDTLADVGAPGAIALAFDLEDAGPLGGDLDTVRVFHELGVRSLLPTYNHANAAGC      120
121      GCLDTEDTGLTAYGRDLVRVLNEVGVFVDGAHCSRRTGLDLAEHTDVPMIYSHANFAALW      180
181      EHPRNITDDQARACAATGGVIGINGVGIFLGRNRPEQAAERVEAMADHIQYGAELVGIEH      240
241      IGIGSDYSFDAADFNAELTENPGAFSDAYTAWGPLQWTAPEELLGLDSVPGLDQVLAARG      300
301      FTPADLAAVFGGNFCRAASKVWREH                                         325