Sequence for MER0037026

>MER0037026 - bacterial proteasome, alpha subunit [T01.980] peptidase unit: 8-235 ( active site residue(s): 19  ) (Nocardia farcinica) (Source: UniProt Q5YUX3) 
1        MTLPYYASAEQIMRDKTELARKGIARGRSVVVLTYDKGVLFVAENPSATLHKVSELYDRI       60
61       GFAAVGKYNEFESLRRGGILQADLRGYQYDRRDVTGRALANAYAQALGTVFNDQLKPFEV      120
121      EICVAEVGYPEQSPEAVLYRINFDGAIVDEREFVVMGGTTEPIVAALKDSYQPGLDLSSA      180
181      VGVAVQALQASGPEGADKEKRTIGVSQLEVATLEQARPRRAFRRVTKTALEQLLVGNGVD      240
241      TSVGKATTTVELPEEPAE                                                258