Sequence for MER0018561

>MER0018561 - ovomucoid inhibitor unit 3 [I01.003] inhibitor unit: 136-186 (Coturnix coturnix) (Source: UniProt P01003) 
1        VEVDCSRFPNTTNEEGKDEVVCPDELRLICGTDGVTYNHECMLCFYNKEYGTNISKEQDG       60
61       ECGETVPMDCSRYPNTTSEDGKVTILCTKDFSFVCGTDGVTYDNECMLCAHNVVQGTSVG      120
121      KKHDGECRKELAAVSVDCSEYPKPACPKDYRPVCGSDNKTYSNKCNFCNAVVESNGTLTL      180
181      NHFGKC                                                            186