Sequence for MER0015158

>MER0015158 - membrane-type matrix metallopeptidase-5 [M10.023] peptidase unit: 125-315 ( active site residue(s): 256 metal ligand(s): 255,259,265 ) (Rattus norvegicus) (Source: UniProt Q99PW6) 
1        MPRSRGGRAAPGQAARWSGWRAPGRLLPLLPALCCLAAAAGAGKPAGADAPFAGQNWLKS       60
61       YGYLLPYESRASALHSGKALQSAVSTMQQFYGIPVTGVLDQTTIEWMKKPRCGVPDHPHL      120
121      SRRRRNKRYALTGQKWRQKHITYSIHNYTPKVGELDTRKAIRQAFDVWQKVTPLTFEEVP      180
181      YHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLG      240
241      NANHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNFKLPQDDLQGIQKIYG      300
301      PPAEPLEPTRPLPTLPVRRIHSPSERKHERQPRPPRPPLGDRPSTPGAKPNICDGNFNTV      360
361      ALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQFWKGLPARIDAAYERADGRFVFFKGDK      420
421      YWVFKEVTVEPGYPHSLGELGSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATD      480
481      PGYPKPITVWKGIPQAPQGAFISKEGYYTYFYKGRDYWKFDNQKLSVEPGYPRNILRDWM      540
541      GCKQKEVERRKERRLPQDDVDIMVTIDDVPGSVNAVAVVVPCTLSLCLLVLLYTIFQFKN      600
601      KTGPQPVTYYKRPVQEWV                                                618