"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"H2QRI2"	"{'domain_architectures': 925, 'entries': 4, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pirsf': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 925}"	"['Required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Together with GET1/WRB, acts as a membrane receptor for soluble GET3/TRC40, which recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. Required for the stability of GET1. Stimulates calcium signaling in T cells through its involvement in elevation of intracellular calcium. Essential for the survival of peripheral follicular B cells']"	"CAMLG"	""	"H2QRI2_PANTR"	"0c3e162740490677398d7c4defb23e40fe496de4"	True	False	296	"Guided entry of tail-anchored proteins factor"	4	"UP000002277"	"MESMAVATDGGERPGVPAGSGLSASQRRAELRRRKLLMNSEQRINRIMGFHRPGSGAEEESQTKSKQQDSDKLNSLSVPSVSKRVVLGDSVSTGTTDQQGGVAEVKGTQLGDKLDSFIKPPECSNDVNLELRQRNRGDLTADSVQRGSRHGLEQYLSRFEEAMKLRKQLISEKPSQEDGNTTEEFDSFRIFRLVGCALLALGVRAFVCKYLSIFAPFLTLQLAYMGLYKYFPKSEKKIKTTVLTAALLLSGIPAEVINRSMDTYSKMGEVFTDLCVYFFTFIFCHELLDYWGSEVP"	"unreviewed"	"{'taxId': '9598', 'scientificName': 'Pan troglodytes', 'fullName': 'Pan troglodytes (Chimpanzee)'}"