GET /interpro/api/protein/unreviewed/A0A6I9ZLT2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 110.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6I9ZLT2",
"id": "A0A6I9ZLT2_ACIJB",
"source_organism": {
"taxId": "32536",
"scientificName": "Acinonyx jubatus",
"fullName": "Acinonyx jubatus (Cheetah)"
},
"name": "Peroxiredoxin-like 2A",
"description": [
"Involved in redox regulation of the cell. Acts as an antioxidant. Inhibits TNFSF11-induced NFKB1 and JUN activation and osteoclast differentiation. May affect bone resorption and help to maintain bone mass. Acts as a negative regulator of macrophage-mediated inflammation by inhibiting macrophage production of inflammatory cytokines, probably through suppression of the MAPK signaling pathway"
],
"length": 229,
"sequence": "MSFLQDPSFFTMGMWSIGAGALGAAALALFLANTDVFLPKSRRATLEYLEDIDLKTLEKEPRTFKAKELWEKNGAVIMAVRRPGCFLCREEAADLSSLKPKLDELGVPLYAVVKEQIRTEVKDFQPYFKGEIFLDEKKKFYGPQKRKMVFMGFVRLGVWYNFFRAWNGGFSGNLEGEGFILGGVFVVGPGKQGLLLEHREKEFGDKVNLASVLEAARKIQPQTSASETK",
"proteome": "UP001652583",
"gene": "PRXL2A",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"ida_accession": "443fb9c0d4ac90645217a3004302a8d616e2ab64",
"counters": {
"domain_architectures": 8621,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"pfam": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 8621
}
}
}