General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 110.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A3Q0G587",
        "id": "A0A3Q0G587_ALLSI",
        "source_organism": {
            "taxId": "38654",
            "scientificName": "Alligator sinensis",
            "fullName": "Alligator sinensis (Chinese alligator)"
        },
        "name": "LLGL scribble cell polarity complex component 2",
        "description": [
            "Part of a complex with GPSM2/LGN, PRKCI/aPKC and PARD6B/Par-6, which may ensure the correct organization and orientation of bipolar spindles for normal cell division. This complex plays roles in the initial phase of the establishment of epithelial cell polarity"
        ],
        "length": 347,
        "sequence": "MRRFLRSGHDPVRERLKRDLFQFNKTVEHGFPHQPSALGYSSSLHLMAIGTRSGAIKLYGAPGVEFMGLHEENNTVLQMHFIPGQCQLVTLLDDNSLHLWSLKQRSGTSELQEEQRFTLRGPPGSSPSATQITVVLPHSSREVLYLGTESGNIFVVELPSFRVLEKRTISSETVLQRVPEDYSNRRPCELVEAIQEHPRNPDQILIGYSRGLIVLWDVQSNKATHHFLGSQQLENVFWQRDGRQFISCHYDGSYAQWPVSNDNRQPEPLESKVPYGPFPCKAISKIYWQVTKNGLPYIIFQGGMPRASYGDRHSISVIHGSQQIAFDFTSRVIDFFVISNADPAAGI",
        "proteome": "UP000189705",
        "gene": "LLGL2",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "e952ff562970ef50c26d10c393bba320ac2832ea",
        "counters": {
            "domain_architectures": 2324,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2324
        }
    }
}