General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 110.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A087Y0F0",
        "id": "A0A087Y0F0_POEFO",
        "source_organism": {
            "taxId": "48698",
            "scientificName": "Poecilia formosa",
            "fullName": "Poecilia formosa (Amazon molly)"
        },
        "name": "Armadillo repeat-containing protein 1",
        "description": [
            "In association with mitochondrial contact site and cristae organizing system (MICOS) complex components and mitochondrial outer membrane sorting assembly machinery (SAM) complex components may regulate mitochondrial dynamics playing a role in determining mitochondrial length, distribution and motility"
        ],
        "length": 271,
        "sequence": "MMDALSVVCQLRDLASEPQNRAVIVQDQGCLPGLVLFLDHKNPEVLFATLQTLRYLAELPLNVPIMKNELGMMASLETLIRREGLSLDITALAKEVYGILRAPANPAPRTPEREKRRKPQFFINSTNKKAKSVTLHIQGLDSTQQRGLCEEALLKVKGVISFTFQMASKRCTVRIRSDLPTESLATAIASTKVLSAQQVVKNDAGEEVYVPLNSCGAQVPQNADIPDYLPEEEESPEREVDKAISRTAAKEDSNGSWLNAAASFLTKTFYW",
        "proteome": "UP000028760",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0046872",
                "name": "metal ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "ida_accession": "1f8c0c02973a0220479b3d07396013a9486b9d1f",
        "counters": {
            "domain_architectures": 9349,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 2,
                "pfam": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 9349
        }
    }
}