"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"in_bfvd"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q9YAT1"	"{'domain_architectures': 10463, 'entries': 14, 'isoforms': 0, 'proteomes': 1, 'sets': 2, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cdd': 1, 'pfam': 1, 'cathgene3d': 1, 'hamap': 1, 'ncbifam': 2, 'panther': 1, 'prints': 1, 'prosite': 1, 'interpro': 4}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 10463}"	"['General factor that plays a role in the activation of archaeal genes transcribed by RNA polymerase. Binds specifically to the TATA box promoter element which lies close to the position of transcription initiation (By similarity)']"	"tbp"	"[{'identifier': 'GO:0003677', 'name': 'DNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006352', 'name': 'DNA-templated transcription initiation', 'category': {'code': 'P', 'name': 'biological_process'}}]"	"TBP_AERPE"	"e721059c5827848fbb29ca298444ac100f4b57fd"	True	False	False	203	"TATA-box-binding protein"	3	"UP000002518"	"MSEEISFVKEIDTGVEGLPKPEVKIENIVATVILENQLDLNLIETKIQDVDYNPDQFPGLVYRLESPRVTVLIFKSGKMVITGAKSINQLIHVVKKLLKAFADQGIPISGKPQIQIQNIVASANLKVYIDLEKAALEFENSLYEPEQFPGLIYRMDEPRVVMLIFSSGKMVITGAKMENEVYDAVKKVARKLKEADAIIGIAE"	"reviewed"	"{'taxId': '272557', 'scientificName': 'Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)', 'fullName': 'Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1)'}"