"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q62GJ4"	"{'domain_architectures': 32989, 'entries': 16, 'isoforms': 0, 'proteomes': 1, 'sets': 1, 'structures': 0, 'taxa': 1, 'dbEntries': {'ssf': 1, 'cathgene3d': 2, 'cdd': 1, 'pfam': 1, 'pirsf': 1, 'hamap': 1, 'ncbifam': 1, 'panther': 1, 'prosite': 1, 'interpro': 6}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 32989}"	"['Binds directly to 23S rRNA. The L1 stalk is quite mobile in the ribosome, and is involved in E site tRNA release', 'Protein L1 is also a translational repressor protein, it controls the translation of the L11 operon by binding to its mRNA']"	"rplA"	"[{'identifier': 'GO:0003723', 'name': 'RNA binding', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0003735', 'name': 'structural constituent of ribosome', 'category': {'code': 'F', 'name': 'molecular_function'}}, {'identifier': 'GO:0006412', 'name': 'translation', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0015934', 'name': 'large ribosomal subunit', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"RL1_BURMA"	"5e3872cf7d15195ea5cee583d7e6bb081fb5cc1e"	True	False	232	"Large ribosomal subunit protein uL1"	3	"UP000006693"	"MAKISKRRQAFAAKVDRQKLYPIDDALALVKECASAKFDESIDVAVQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQGEKAEQARAAGAEVVGMEDLAEQIKAGQMDFDIVIASPDTMRIVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQFRVDKAGIIHATIGRASFEPTALRTNLSALIEALQKAKPATSKGVYLRKIALSSTMGVGVRVDQGSLAAQ"	"reviewed"	"{'taxId': '243160', 'scientificName': 'Burkholderia mallei (strain ATCC 23344)', 'fullName': 'Burkholderia mallei (strain ATCC 23344)'}"
