"accession"	"counters"	"description"	"gene"	"go_terms"	"id"	"ida_accession"	"in_alphafold"	"is_fragment"	"length"	"name"	"protein_evidence"	"proteome"	"sequence"	"source_database"	"source_organism"
"Q58DR0"	"{'domain_architectures': 866, 'entries': 3, 'isoforms': 0, 'proteomes': 1, 'sets': 0, 'structures': 0, 'taxa': 1, 'dbEntries': {'panther': 1, 'pfam': 1, 'interpro': 1}, 'proteome': 1, 'taxonomy': 1, 'similar_proteins': 866}"	"[""Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through the cell cycle (By similarity). APC/C acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains (By similarity). APC/C catalyzes assembly of branched 'Lys-11'-/'Lys-48'-linked branched ubiquitin chains on target proteins (By similarity). APC/C is activated by CDC20 in the metaphase/anaphase transition of cell cycle, targeting the degradation of cyclin B and securin (By similarity). APC/C is regulated by the mitotic checkpoint complex (MCC), which inhibits APC/C and delays chromosome segregation (By similarity)""]"	"ANAPC16"	"[{'identifier': 'GO:0016567', 'name': 'protein ubiquitination', 'category': {'code': 'P', 'name': 'biological_process'}}, {'identifier': 'GO:0005680', 'name': 'anaphase-promoting complex', 'category': {'code': 'C', 'name': 'cellular_component'}}]"	"APC16_BOVIN"	"914a8c48418bae6bbcedffec4fcf51d637bd9bfc"	True	False	110	"Anaphase-promoting complex subunit 16"	3	"UP000009136"	"MAASSSSSSAGGVSGSSVAGSGFSVSDLAPPRKALFTYPKGAGEMLEDGSERFLCESVFSYQVASTLKQVKHDQQVARMEKLAGLVEELEADEWRFKPIEQLLGFTPSSG"	"reviewed"	"{'taxId': '9913', 'scientificName': 'Bos taurus', 'fullName': 'Bos taurus (Bovine)'}"